Recombinant Human MPI Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | MPI-162H |
Product Overview : | MPI MS Standard C13 and N15-labeled recombinant protein (NP_002426) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Molecular Mass : | 46.7 kDa |
AA Sequence : | MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MPI mannose phosphate isomerase [ Homo sapiens (human) ] |
Official Symbol | MPI |
Synonyms | MPI; mannose phosphate isomerase; CDG1B; PMI; PMI1; mannose-6-phosphate isomerase; phosphohexomutase; phosphomannose isomerase 1; EC 5.3.1.8 |
Gene ID | 4351 |
mRNA Refseq | NM_002435 |
Protein Refseq | NP_002426 |
MIM | 154550 |
UniProt ID | P34949 |
◆ Recombinant Proteins | ||
MPI-6323HF | Recombinant Full Length Human MPI Protein, GST-tagged | +Inquiry |
Mpi-454M | Recombinant Mouse Mpi Protein, MYC/DDK-tagged | +Inquiry |
MPI-3394R | Recombinant Rat MPI Protein, His (Fc)-Avi-tagged | +Inquiry |
MPI-3395Z | Recombinant Zebrafish MPI | +Inquiry |
MPI-5503H | Recombinant Human MPI Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPI Products
Required fields are marked with *
My Review for All MPI Products
Required fields are marked with *
0
Inquiry Basket