"MPP3" Related Products

Expand

Recombinant Human MPP3, His-tagged

Cat.No.: MPP3-30040TH
Product Overview: Recombinant fragment, corresponding to amino acids 174-585 of Human MPP3 with an N terminal His tag; Predicted MWt 58 kDa.
Description: This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. This protein contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction. Alternatively spliced transcript variants have been identified. One transcript variant is experimentally supported, but it doesnt encode a protein.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 157 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLK IIPATQEEDRLKESKVFMRALFHYNPREDRAIPCQEAG LPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSK GFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDC EGYLKGHYVAGLRRSFRLGCRERLGGSQEGKMSSGAESPE LLTYEEVARYQHQPGERPRLVVLIGSLGARLHELKQKV VAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFE ADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLV DVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPA CEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQ GAYSQLKVVLEKLSKDTHWVPVSWVR
Sequence Similarities: Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 2 L27 domains.Contains 1 PDZ (DHR) domain.Contains 1 SH3 domain.
Gene Name: MPP3 membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) [ Homo sapiens ]
Official Symbol: MPP3
Synonyms: MPP3; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3); DLG3; MAGUK p55 subfamily member 3; discs; large (Drosophila) homolog 3; membrane protein palmitoylated 3;
Gene ID: 4356
mRNA Refseq: NM_001932
Protein Refseq: NP_001923
MIM: 601114
Uniprot ID: Q13368
Chromosome Location: 17q12-q21
Function: PDZ domain binding; guanylate kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.