Recombinant Human MSH2 protein, GST-tagged MSH2-28175TH

Recombinant Human MSH2 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MSH2 protein, GST-tagged

Recombinant Human MSH2 protein, GST-tagged

MSH2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MSH2-28175TH
Product Overview : Recombinant Human MSH2(1 a.a. - 934 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 131.1 kDa
AA Sequence : MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNL QSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGV KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVLPGGETAGDMGKLRQIIQRGGILIT ERKKADFSTKDIYQDLNRLLKGKKGEQMNS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : MSH2 mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [ Homo sapiens ]
Official Symbol : MSH2
Synonyms : MSH2; mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli); COCA1, mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1); DNA mismatch repair protein Msh2; HNPCC; HNPCC1; hMSH2; FCC1; COCA1; LCFS2;
Gene ID : 4436
mRNA Refseq : NM_000251
Protein Refseq : NP_000242
MIM : 609309
UniProt ID : P43246
Chromosome Location : 2p21
Pathway : BRCA1-associated genome surveillance complex (BASC), organism-specific biosystem; Colorectal cancer, organism-specific biosystem; Colorectal cancer, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Mismatch repair, organism-specific biosystem; Mismatch repair, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function : contributes_to ADP binding; contributes_to ATP binding; contributes_to ATPase activity; DNA binding; DNA-dependent ATPase activity; contributes_to MutLalpha complex binding; Y-form DNA binding; centromeric DNA binding; damaged DNA binding; contributes_to dinucleotide insertion or deletion binding; contributes_to dinucleotide repeat insertion binding; double-strand/single-strand DNA junction binding; contributes_to double-stranded DNA binding; enzyme binding; contributes_to four-way junction DNA binding; contributes_to guanine/thymine mispair binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy