"MTHFD1" Related Products

Expand
Expand

Recombinant Human MTHFD1

Cat.No.: MTHFD1-29504TH
Product Overview: Recombinant full length Human MTHFD1 with a N terminal proprietary tag: predicted MW 128.59 kDa.
Description: This gene encodes a protein that possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.
Protein length: 935 amino acids
Molecular Weight: 128.590kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAI LQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESE VMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAP EKDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETG VPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTA HLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINY VPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTV AMLMQSTVESAKRFLEKFKPGKWMIQYNNLNLKTPVPSDI DISRSCKPKPIGKLAREIGLLSEEVELYGETKAKVLLSAL ERLKHRPDGKYVVVTGITPTPLGEGKSTTTIGLVQALGAH LYQNVFACVRQPSQGPTFGIKGGAAGGGYSQVIPMEEFNL HLTGDIHAITAANNLVAAAIDARIFHELTQTDKALFNRLV PSVNGVRRFSDIQIRRLKRLGIEKTDPTTLTDEEINRFAR LDIDPETITWQRVLDTNDRFLRKITIGQAPTEKGHTRTAQ FDISVASEIMAVLALTTSLEDMRERLGKMVVASSKKGEPV SAEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFA NIAHGNSSIIADQIALKLVGPEGFVVTEAGFGADIGMEKF FNIKCRYSGLCPHVVVLVATVRALKMHGGGPTVTAGLPLP KAYIQENLELVEKGFSNLKKQIENARMFGIPVVVAVNAFK TDTESELDLISRLSREHGAFDAVKCTHWAEGGKGALALAQ AVQRAAQAPSSFQLLYDLKLPVEDKIRIIAQKIYGADDIE LLPEAQHKAEVYTKQGFGNLPICMAKTHLSLSHNPEQKGV PTGFILPIRDIRASVGAGFLYPLVGTMSTMPGLPTRPCFY DIDLDPETEQVNGLF
Sequence Similarities: In the N-terminal section; belongs to the tetrahydrofolate dehydrogenase/cyclohydrolase family.In the C-terminal section; belongs to the formate--tetrahydrofolate ligase family.
Gene Name: MTHFD1 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase [ Homo sapiens ]
Official Symbol: MTHFD1
Synonyms: MTHFD1; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase; MTHFC, MTHFD; C-1-tetrahydrofolate synthase, cytoplasmic;
Gene ID: 4522
mRNA Refseq: NM_005956
Protein Refseq: NP_005947
Uniprot ID: P11586
Chromosome Location: 14q24
Pathway: C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of folate and pterines, organism-specific biosystem;
Function: ATP binding; formate-tetrahydrofolate ligase activity; hydrolase activity; ligase activity; methenyltetrahydrofolate cyclohydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.