Recombinant Human MYD88

• Cat.No.: MYD88-29151TH
• Product Overview: Recombinant fragment corressponding to amino acids 31-130 of Human MyD88 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitous.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ
• Sequence Similarities: Contains 1 death domain.Contains 1 TIR domain.

Gene Information

• Gene Name: MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ]
• Official Symbol: MYD88
• Synonyms: MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88
• Gene ID: 4615
• mRNA Refseq: NM_001172566
• Protein Refseq: NP_001166037
• MIM: 602170
• Uniprot ID: Q99836
• Chromosome Location: 3p22
• Pathway: Activated TLR4 signalling, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem
• Function: TIR domain binding; Toll binding; death receptor binding; identical protein binding; protein binding