"MYD88" Related Products

Expand
Expand
Expand

Recombinant Human MYD88

Cat.No.: MYD88-29151TH
Product Overview: Recombinant fragment corressponding to amino acids 31-130 of Human MyD88 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
Description: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ
Sequence Similarities: Contains 1 death domain.Contains 1 TIR domain.
Gene Name: MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ]
Official Symbol: MYD88
Synonyms: MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88;
Gene ID: 4615
mRNA Refseq: NM_001172566
Protein Refseq: NP_001166037
MIM: 602170
Uniprot ID: Q99836
Chromosome Location: 3p22
Pathway: Activated TLR4 signalling, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem;
Function: TIR domain binding; Toll binding; death receptor binding; identical protein binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.