"MYL2" Related Products

Expand
Expand
Expand

Recombinant Human MYL2, His-tagged

Cat.No.: MYL2-27837TH
Product Overview: Recombinant full length Human Myosin Light Chain 2 with N-terminal His tag; 186aa, 20.9 kDa.
Description: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.
Protein length: 166 amino acids
Conjugation: HIS
Molecular Weight: 20.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.24% Tris, 20% Glycerol, 0.05% Calcium chloride
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSM FEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD
Sequence Similarities: Contains 3 EF-hand domains.
Gene Name: MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ]
Official Symbol: MYL2
Synonyms: MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10;
Gene ID: 4633
mRNA Refseq: NM_000432
Protein Refseq: NP_000423
MIM: 160781
Uniprot ID: P10916
Chromosome Location: 12q24.11
Pathway: CDC42 signaling events, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem;
Function: actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.