Recombinant Human MYL2, His-tagged

• Cat.No.: MYL2-27837TH
• Product Overview: Recombinant full length Human Myosin Light Chain 2 with N-terminal His tag; 186aa, 20.9 kDa.

Specification

• Description: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.
• Protein length: 166 amino acids
• Conjugation: HIS
• Molecular Weight: 20.900kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.24% Tris, 20% Glycerol, 0.05% Calcium chloride
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSM FEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ]
• Official Symbol: MYL2
• Synonyms: MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10
• Gene ID: 4633
• mRNA Refseq: NM_000432
• Protein Refseq: NP_000423
• MIM: 160781
• Uniprot ID: P10916
• Chromosome Location: 12q24.11
• Pathway: CDC42 signaling events, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem
• Function: actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle