Recombinant Human MYL2, His-tagged
Cat.No. : | MYL2-27837TH |
Product Overview : | Recombinant full length Human Myosin Light Chain 2 with N-terminal His tag; 186aa, 20.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 166 amino acids |
Description : | Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. |
Conjugation : | HIS |
Molecular Weight : | 20.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.24% Tris, 20% Glycerol, 0.05% Calcium chloride |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAPKKAKKRAGGANSNVFSM FEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETIL NAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA AFPPDVTGNLDYKNLVHIITHGEEKD |
Sequence Similarities : | Contains 3 EF-hand domains. |
Gene Name | MYL2 myosin, light chain 2, regulatory, cardiac, slow [ Homo sapiens ] |
Official Symbol | MYL2 |
Synonyms | MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10; |
Gene ID | 4633 |
mRNA Refseq | NM_000432 |
Protein Refseq | NP_000423 |
MIM | 160781 |
Uniprot ID | P10916 |
Chromosome Location | 12q24.11 |
Pathway | CDC42 signaling events, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; |
Function | actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle; |
◆ Recombinant Proteins | ||
MYL2-1467H | Recombinant Human MYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYL2-6759HF | Recombinant Full Length Human MYL2 Protein, GST-tagged | +Inquiry |
MYL2-4680C | Recombinant Chicken MYL2 | +Inquiry |
MYL2-10314M | Recombinant Mouse Myl2 Protein, Myc/DDK-tagged | +Inquiry |
MYL2-3513R | Recombinant Rat MYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL2-4028HCL | Recombinant Human MYL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL2 Products
Required fields are marked with *
My Review for All MYL2 Products
Required fields are marked with *