Recombinant Full Length Human MYL2 Protein, GST-tagged
| Cat.No. : | MYL2-6759HF |
| Product Overview : | Human MYL2 full-length ORF ( AAH15821.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 166 amino acids |
| Description : | Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq |
| Molecular Mass : | 44.00 kDa |
| AA Sequence : | MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYL2 myosin light chain 2 [ Homo sapiens (human) ] |
| Official Symbol | MYL2 |
| Synonyms | MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10; MLC-2; MLC-2v; RLC of myosin; myosin light chain 2; regulatory light chain of myosin; slow cardiac myosin regulatory light chain 2; MLC2; DKFZp779C0562; |
| Gene ID | 4633 |
| mRNA Refseq | NM_000432 |
| Protein Refseq | NP_000423 |
| MIM | 160781 |
| UniProt ID | P10916 |
| ◆ Recombinant Proteins | ||
| MYL2-388H | Recombinant Human Slow Cardiac Myosin Regulatory light chain 2, His-tagged | +Inquiry |
| MYL2-27837TH | Recombinant Human MYL2, His-tagged | +Inquiry |
| MYL2-4647H | Recombinant Human MYL2 Protein (Ala2-Ile159), N-His tagged | +Inquiry |
| MYL2-10314M | Recombinant Mouse Myl2 Protein, Myc/DDK-tagged | +Inquiry |
| MYL2-6759HF | Recombinant Full Length Human MYL2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL2-4028HCL | Recombinant Human MYL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL2 Products
Required fields are marked with *
My Review for All MYL2 Products
Required fields are marked with *
