Recombinant Full Length Human MYL2 Protein, GST-tagged

Cat.No. : MYL2-6759HF
Product Overview : Human MYL2 full-length ORF ( AAH15821.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 166 amino acids
Description : Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq
Molecular Mass : 44.00 kDa
AA Sequence : MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYL2 myosin light chain 2 [ Homo sapiens (human) ]
Official Symbol MYL2
Synonyms MYL2; myosin, light chain 2, regulatory, cardiac, slow; myosin, light polypeptide 2, regulatory, cardiac, slow; myosin regulatory light chain 2, ventricular/cardiac muscle isoform; cardiac ventricular myosin light chain 2; CMH10; MLC-2; MLC-2v; RLC of myosin; myosin light chain 2; regulatory light chain of myosin; slow cardiac myosin regulatory light chain 2; MLC2; DKFZp779C0562;
Gene ID 4633
mRNA Refseq NM_000432
Protein Refseq NP_000423
MIM 160781
UniProt ID P10916

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL2 Products

Required fields are marked with *

My Review for All MYL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon