"MYL6B" Related Products

Expand
Expand
Expand

Recombinant Human MYL6B, His-tagged

Cat.No.: MYL6B-30243TH
Product Overview: Recombinant full length Human MLC1SA with an N terminal His tag; 231 amino acids with the tag; predicted MWt: 25.2 kDa.
Description: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
Protein length: 208 amino acids
Conjugation: HIS
Molecular Weight: 25.200kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.02% DTT, 0.32% Tris-HCl buffer
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Sequence Similarities: Contains 3 EF-hand domains.
Gene Name: MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ]
Official Symbol: MYL6B
Synonyms: MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a;
Gene ID: 140465
mRNA Refseq: NM_001199629
Protein Refseq: NP_001186558
MIM: 609930
Uniprot ID: P14649
Chromosome Location: 12q13.2
Pathway: Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem;
Function: calcium ion binding; motor activity; protein binding; structural constituent of muscle;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.