Recombinant Human MYLPF, His-tagged
Cat.No. : | MYLPF-30271TH |
Product Overview : | Recombinant full length Human MYLPF with an N terminal His tag; 189aa, 21.2kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 169 amino acids |
Description : | Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti |
Conjugation : | HIS |
Molecular Weight : | 21.200kDa inclusive of tags |
Tissue specificity : | Expressed in fetal and adult skeletal muscle. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
Sequence Similarities : | Contains 3 EF-hand domains. |
Gene Name | MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ] |
Official Symbol | MYLPF |
Synonyms | MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; |
Gene ID | 29895 |
mRNA Refseq | NM_013292 |
Protein Refseq | NP_037424 |
Uniprot ID | Q96A32 |
Chromosome Location | 16p11.2 |
Pathway | ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; |
Function | calcium ion binding; structural constituent of muscle; |
◆ Recombinant Proteins | ||
MYLPF-7855H | Recombinant Human MYLPF protein, GST-tagged | +Inquiry |
MYLPF-3519R | Recombinant Rat MYLPF Protein, His (Fc)-Avi-tagged | +Inquiry |
MYLPF-5827H | Recombinant Human MYLPF Protein, GST-tagged | +Inquiry |
MYLPF-7854H | Recombinant Human MYLPF protein, His-tagged | +Inquiry |
Mylpf-4259M | Recombinant Mouse Mylpf Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYLPF Products
Required fields are marked with *
My Review for All MYLPF Products
Required fields are marked with *