"MYLPF" Related Products

Expand
Expand
Expand

Recombinant Human MYLPF, His-tagged

Cat.No.: MYLPF-30271TH
Product Overview: Recombinant full length Human MYLPF with an N terminal His tag; 189aa, 21.2kDa inclusive of tag.
Description: Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
Protein length: 169 amino acids
Conjugation: HIS
Molecular Weight: 21.200kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in fetal and adult skeletal muscle.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Sequence Similarities: Contains 3 EF-hand domains.
Gene Name: MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
Official Symbol: MYLPF
Synonyms: MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory;
Gene ID: 29895
mRNA Refseq: NM_013292
Protein Refseq: NP_037424
Uniprot ID: Q96A32
Chromosome Location: 16p11.2
Pathway: ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem;
Function: calcium ion binding; structural constituent of muscle;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.