"MYLPF" Related Products

Expand
Expand

Recombinant Human MYLPF

Cat.No. : MYLPF-30272TH
Product Overview : Recombinant full length Human MYLPF with a proprietary tag, MWt 44.7kDa.
Description : Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti
Protein length : 169 amino acids
Molecular Weight : 44.700kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in fetal and adult skeletal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name : MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
Official Symbol : MYLPF
Synonyms : MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory;
Gene ID : 29895
mRNA Refseq : NM_013292
Protein Refseq : NP_037424
Uniprot ID : Q96A32
Chromosome Location : 16p11.2
Pathway : ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem;
Function : calcium ion binding; structural constituent of muscle;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.