"NBR1" Related Products

Recombinant Human NBR1

Cat.No.: NBR1-27854TH
Product Overview: Recombinant fragment of Human NBR1, amino acids 2-96: EPQVTLNVTF KNEIQSFLVS DPENTTWADI EAMVKVSFDL NTIQIKYLDE ENEEVSINSQ GEYEEALKMA VKQGNQLQMQ VHEGHHVVDE APPPV with a proprietary N-terminal tag, molecular weight 36.08 inclusive of tag
Description: The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene.
Protein length: 95 amino acids
Molecular Weight: 36.080kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Sequence Similarities: Contains 1 OPR domain.Contains 1 UBA domain.Contains 1 ZZ-type zinc finger.
Gene Name: NBR1 neighbor of BRCA1 gene 1 [ Homo sapiens ]
Official Symbol: NBR1
Synonyms: NBR1; neighbor of BRCA1 gene 1; M17S2, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); next to BRCA1 gene 1 protein; 1A1 3B; CA125; KIAA0049;
Gene ID: 4077
mRNA Refseq: NM_005899
Protein Refseq: NP_005890
MIM: 166945
Uniprot ID: Q14596
Chromosome Location: 17q21.31
Function: metal ion binding; mitogen-activated protein kinase p38 binding; protein binding; ubiquitin binding; zinc ion binding;
Products Types ◆ Recombinant Protein

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.