Recombinant Human NBR1
Cat.No. : | NBR1-27854TH |
Product Overview : | Recombinant fragment of Human NBR1, amino acids 2-96: EPQVTLNVTF KNEIQSFLVS DPENTTWADI EAMVKVSFDL NTIQIKYLDE ENEEVSINSQ GEYEEALKMA VKQGNQLQMQ VHEGHHVVDE APPPV with a proprietary N-terminal tag, molecular weight 36.08 inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 95 amino acids |
Description : | The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. |
Molecular Weight : | 36.080kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
Sequence Similarities : | Contains 1 OPR domain.Contains 1 UBA domain.Contains 1 ZZ-type zinc finger. |
Gene Name | NBR1 neighbor of BRCA1 gene 1 [ Homo sapiens ] |
Official Symbol | NBR1 |
Synonyms | NBR1; neighbor of BRCA1 gene 1; M17S2, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); next to BRCA1 gene 1 protein; 1A1 3B; CA125; KIAA0049; |
Gene ID | 4077 |
mRNA Refseq | NM_005899 |
Protein Refseq | NP_005890 |
MIM | 166945 |
Uniprot ID | Q14596 |
Chromosome Location | 17q21.31 |
Function | metal ion binding; mitogen-activated protein kinase p38 binding; protein binding; ubiquitin binding; zinc ion binding; |
◆ Recombinant Proteins | ||
NBR1-912M | Recombinant Mouse ear watercress NBR1 protein, His-tagged | +Inquiry |
NBR1-3913R | Recombinant Rat NBR1 Protein | +Inquiry |
NBR1-3368H | Recombinant Human NBR1 protein, His-tagged | +Inquiry |
NBR1-3572R | Recombinant Rat NBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NBR1-27854TH | Recombinant Human NBR1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NBR1-3956HCL | Recombinant Human NBR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NBR1 Products
Required fields are marked with *
My Review for All NBR1 Products
Required fields are marked with *
0
Inquiry Basket