Recombinant Human NBR1

Cat.No. : NBR1-27854TH
Product Overview : Recombinant fragment of Human NBR1, amino acids 2-96: EPQVTLNVTF KNEIQSFLVS DPENTTWADI EAMVKVSFDL NTIQIKYLDE ENEEVSINSQ GEYEEALKMA VKQGNQLQMQ VHEGHHVVDE APPPV with a proprietary N-terminal tag, molecular weight 36.08 inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 95 amino acids
Description : The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene.
Molecular Weight : 36.080kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Sequence Similarities : Contains 1 OPR domain.Contains 1 UBA domain.Contains 1 ZZ-type zinc finger.
Gene Name NBR1 neighbor of BRCA1 gene 1 [ Homo sapiens ]
Official Symbol NBR1
Synonyms NBR1; neighbor of BRCA1 gene 1; M17S2, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); next to BRCA1 gene 1 protein; 1A1 3B; CA125; KIAA0049;
Gene ID 4077
mRNA Refseq NM_005899
Protein Refseq NP_005890
MIM 166945
Uniprot ID Q14596
Chromosome Location 17q21.31
Function metal ion binding; mitogen-activated protein kinase p38 binding; protein binding; ubiquitin binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NBR1 Products

Required fields are marked with *

My Review for All NBR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon