"NDN" Related Products

Recombinant Human NDN

Cat.No.: NDN-30373TH
Product Overview: Recombinant full length Human Necdin with N terminal proprietary tag, 61.38kDa.
Description: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons.
Protein length: 321 amino acids
Molecular Weight: 61.380kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leuko
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAE PQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAH QAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIW FPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSL HTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYV KGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFV QMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSE D
Sequence Similarities: Contains 1 MAGE domain.
Gene Name: NDN necdin homolog (mouse) [ Homo sapiens ]
Official Symbol: NDN
Synonyms: NDN; necdin homolog (mouse); necdin (mouse) homolog; necdin; HsT16328; PWCR;
Gene ID: 4692
mRNA Refseq: NM_002487
Protein Refseq: NP_002478
MIM: 602117
Uniprot ID: Q99608
Chromosome Location: 15q11-q12
Pathway: Adipogenesis, organism-specific biosystem; p75(NTR)-mediated signaling, organism-specific biosystem;
Function: DNA binding; gamma-tubulin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.