"NDUFB10" Related Products

Recombinant Human NDUFB10, His-tagged

Cat.No.: NDUFB10-28708TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-172 of Human NDUFB10 with N terminal His tag. Predicted mwt: 22 kDa;
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 68 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVT LVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMC MYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQ QNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQR MLQERKAAKEAAAATS
Sequence Similarities: Belongs to the complex I NDUFB10 subunit family.
Gene Name: NDUFB10 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa [ Homo sapiens ]
Official Symbol: NDUFB10
Synonyms: NDUFB10; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10; complex I PDSW subunit; PDSW;
Gene ID: 4716
mRNA Refseq: NM_004548
Protein Refseq: NP_004539
MIM: 603843
Uniprot ID: O96000
Chromosome Location: 16p13.3
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function: NADH dehydrogenase (ubiquinone) activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.