"NEDD9" Related Products

Expand

Recombinant Human NEDD9, His-tagged

Cat.No.: NEDD9-29304TH
Product Overview: Recombinant fragment, corresponding to amino acids 414-834 of Human HEF1 with an N terminal His tag. Observed mwt: 52 kDa predicted mwt: 49 kDa;
Description: Enhancer of filamentation 1 is a protein that in humans is encoded by the NEDD9 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Higher levels detected in kidney, lung, and placenta. Also detected in T-cells, B-cells and diverse cell lines. The protein has been detected in lymphocytes, in diverse cell lines, and in lung tissues.
Form: Lyophilised:Reconstitute with 116 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVD KVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQR VEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRF VMVAKTVPDDAKQLTTTINTNAEALFRPGPGSLHLKNG PESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGL SKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKEL LEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDIS KWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFISLL NAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTL TRQVTAQDIRNKVMNSSNQLCEQLKTIVMATKMAALHY PSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF
Sequence Similarities: Belongs to the CAS family.Contains 1 SH3 domain.
Gene Name: NEDD9 neural precursor cell expressed, developmentally down-regulated 9 [ Homo sapiens ]
Official Symbol: NEDD9
Synonyms: NEDD9; neural precursor cell expressed, developmentally down-regulated 9; enhancer of filamentation 1; Cas scaffolding protein family member 2; CAS L; Cas like; CASS2; HEF1;
Gene ID: 4739
mRNA Refseq: NM_001142393
Protein Refseq: NP_001135865
MIM: 602265
Uniprot ID: Q14511
Chromosome Location: 6p25-p24
Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.