"NFE2" Related Products

Expand
Expand
Expand

Recombinant Human NFE2

Cat.No.: NFE2-28428TH
Product Overview: Recombinant full length Human Nuclear Factor Erythroid Derived 2 with N terminal proprietary tag. Predicted MW 66.77 kDa.
Description: Transcription factor NF-E2 45 kDa subunit is a protein that in humans is encoded by the NFE2 gene.
Protein length: 373 amino acids
Molecular Weight: 66.770kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in hematopoietic cells and also in colon and testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGL NAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPP PPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPL QDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLEL EGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAE TPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTD KIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLE VMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTI FLVPRGTKMEATD
Sequence Similarities: Belongs to the bZIP family. CNC subfamily.Contains 1 bZIP domain.
Gene Name: NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ]
Official Symbol: NFE2
Synonyms: NFE2; nuclear factor (erythroid-derived 2), 45kDa; nuclear factor (erythroid derived 2), 45kD; transcription factor NF-E2 45 kDa subunit; NF E2;
Gene ID: 4778
mRNA Refseq: NM_001136023
Protein Refseq: NP_001129495
MIM: 601490
Uniprot ID: Q16621
Chromosome Location: 12q13
Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function: WW domain binding; WW domain binding; protein N-terminus binding; protein dimerization activity; sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.