"NISCH" Related Products

Recombinant Human NISCH, His-tagged

Cat.No.: NISCH-27759TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-539 of Human NISCH with an N terminal His tag; Predicted MWt: 61 kDa;
Description: Nischarin is a protein that in humans is encoded by the NISCH gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 93 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MATARTFGPEREAEPAKEARVVGSELVDTYTVYIIQVTDG SHEWTVKHRYSDFHDLHEKLVAERKIDKNLLPPKKIIG KNSRSLVEKREKDLEVYLQKLLAAFPGVTPRVLAHFLH FHFYEINGITAALAEELFEKGEQLLGAGEVFAIGPLQL YAVTEQLQQGKPTCASGDAKTDLGHILDFTCRLKYLKVSG TEGPFGTSNIQEQLLPFDLSIFKSLHQVEISHCDAKHI RGLVASKPTLATLSVRFSATSMKEVLVPEASEFDEWEP EGTTLEGPVTAVIPTWQALTTLDLSHNSISEIDESVKL IPKIEFLDLSHNGLLVVDNLQHLYNLVHLDLSYNKLSS LEGLHTKLGNIKTLNLAGNLLESLSGLHKLYSLVNLDLRD NRIEQMEEVRSIGSLPCLEHVSLLNNPLSIIPDYRTKV LAQFGERASEVCLDDTVTTEKELDTVEVLKAIQKAKEV KSKLSNPEKKGGEDSRLSAAPCIRPSSSPPTVAPASAS LPQPILSNQGIMFVQEEALASSLSSTDSLTPEHQPIAQG
Gene Name: NISCH nischarin [ Homo sapiens ]
Official Symbol: NISCH
Synonyms: NISCH; nischarin; I 1; I 1 receptor candidate protein; imidazoline receptor antisera selected; imidazoline receptor candidate; IRAS; KIAA0975;
Gene ID: 11188
mRNA Refseq: NM_007184
Protein Refseq: NP_009115
Uniprot ID: Q9Y2I1
Chromosome Location: 3p21.1
Pathway: Hypothetical Network for Drug Addiction, organism-specific biosystem;
Function: G-protein coupled amine receptor activity; integrin binding; phosphatidylinositol binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.