Recombinant Human NISCH Protein, GST-tagged
| Cat.No. : | NISCH-5878H |
| Product Overview : | Human NISCH partial ORF ( AAH56900, 1246 a.a. - 1345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a nonadrenergic imidazoline-1 receptor protein that localizes to the cytosol and anchors to the inner layer of the plasma membrane. The orthologous mouse protein has been shown to influence cytoskeletal organization and cell migration by binding to alpha-5-beta-1 integrin. In humans, this protein has been shown to bind to the adapter insulin receptor substrate 4 (IRS4) to mediate translocation of alpha-5 integrin from the cell membrane to endosomes. Expression of this protein was reduced in human breast cancers while its overexpression reduced tumor growth and metastasis; possibly by limiting the expression of alpha-5 integrin. In human cardiac tissue, this gene was found to affect cell growth and death while in neural tissue it affected neuronal growth and differentiation. Alternative splicing results in multiple transcript variants encoding differerent isoforms. Some isoforms lack the expected C-terminal domains of a functional imidazoline receptor. [provided by RefSeq, Jan 2013] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | LTGSTPMQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEPVDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLTFTVAQKMAEPEKAPAL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NISCH nischarin [ Homo sapiens ] |
| Official Symbol | NISCH |
| Synonyms | NISCH; nischarin; I 1; I 1 receptor candidate protein; imidazoline receptor antisera selected; imidazoline receptor candidate; IRAS; KIAA0975; IR1; hIRAS; I1R candidate protein; imidazoline receptor 1; I-1 receptor candidate protein; imidazoline-1 receptor candidate protein; imidazoline receptor antisera-selected protein; I-1; FLJ14425; FLJ40413; FLJ90519; |
| Gene ID | 11188 |
| mRNA Refseq | NM_007184 |
| Protein Refseq | NP_009115 |
| UniProt ID | Q9Y2I1 |
| ◆ Recombinant Proteins | ||
| NISCH-10680M | Recombinant Mouse NISCH Protein | +Inquiry |
| Nisch-300M | Recombinant Mouse Nisch Protein, His/GST-tagged | +Inquiry |
| NISCH-3966H | Recombinant Human NISCH Protein (Leu1246-Ser1346), N-GST tagged | +Inquiry |
| NISCH-5878H | Recombinant Human NISCH Protein, GST-tagged | +Inquiry |
| NISCH-6076M | Recombinant Mouse NISCH Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NISCH Products
Required fields are marked with *
My Review for All NISCH Products
Required fields are marked with *
