"NPC1" Related Products

Expand
Expand

Recombinant Human NPC1

Cat.No.: NPC1-29132TH
Product Overview: Recombinant fragment, corresponding to amino acids 151-250 of Human Niemann Pick C1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa
Description: This gene encodes a large protein that resides in the limiting membrane of endosomes and lysosomes and mediates intracellular cholesterol trafficking via binding of cholesterol to its N-terminal domain. It is predicted to have a cytoplasmic C-terminus, 13 transmembrane domains, and 3 large loops in the lumen of the endosome - the last loop being at the N-terminus. This protein transports low-density lipoproteins to late endosomal/lysosomal compartments where they are hydrolized and released as free cholesterol. Defects in this gene cause Niemann-Pick type C disease, a rare autosomal recessive neurodegenerative disorder characterized by over accumulation of cholesterol and glycosphingolipids in late endosomal/lysosomal compartments.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK
Sequence Similarities: Belongs to the patched family.Contains 1 SSD (sterol-sensing) domain.
Gene Name: NPC1 Niemann-Pick disease, type C1 [ Homo sapiens ]
Official Symbol: NPC1
Synonyms: NPC1; Niemann-Pick disease, type C1; Niemann-Pick C1 protein;
Gene ID: 4864
mRNA Refseq: NM_000271
Protein Refseq: NP_000262
MIM: 607623
Uniprot ID: O15118
Chromosome Location: 18q11-q12
Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function: hedgehog receptor activity; protein binding; receptor activity; sterol transporter activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.