Recombinant Human NPC1, GST-tagged
| Cat.No. : | NPC1-29133TH |
| Product Overview : | Recombinant Human NPC1(151 a.a. - 250 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a large protein that resides in the limiting membrane of endosomes and lysosomes and mediates intracellular cholesterol trafficking via binding of cholesterol to its N-terminal domain. It is predicted to have a cytoplasmic C-terminus, 13 transmembrane domains, and 3 large loops in the lumen of the endosome - the last loop being at the N-terminus. This protein transports low-density lipoproteins to late endosomal/lysosomal compartments where they are hydrolized and released as free cholesterol. Defects in this gene cause Niemann-Pick type C disease, a rare autosomal recessive neurodegenerative disorder characterized by over accumulation of cholesterol and glycosphingolipids in late endosomal/lysosomal compartments. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATK GCDESVDEVTAPCSCQDCSIVCGPK |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NPC1 Niemann-Pick disease, type C1 [ Homo sapiens (human) ] |
| Official Symbol | NPC1 |
| Synonyms | NPC1; NPC; Niemann-Pick disease, type C1; Niemann-Pick C1 protein |
| Gene ID | 4864 |
| mRNA Refseq | NM_000271 |
| Protein Refseq | NP_000262 |
| MIM | 607623 |
| UniProt ID | O15118 |
| Chromosome Location | 18q11.2 |
| Pathway | Lysosome |
| Function | cholesterol binding; hedgehog receptor activity; protein binding |
| ◆ Recombinant Proteins | ||
| NPC1-1338H | Recombinant Human NPC1 protein, His-tagged | +Inquiry |
| NPC1-1339H | Recombinant Human NPC1 protein, His/FLAG-tagged | +Inquiry |
| NPC1-8054Z | Recombinant Zebrafish NPC1 | +Inquiry |
| NPC1-4432H | Recombinant Human NPC1 protein, His-Myc-tagged | +Inquiry |
| NPC1-4725H | Recombinant Human NPC1 Protein (Gln23-Asp266), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPC1 Products
Required fields are marked with *
My Review for All NPC1 Products
Required fields are marked with *



