Recombinant Human NPC1
Cat.No. : | NPC1-29132TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 151-250 of Human Niemann Pick C1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a large protein that resides in the limiting membrane of endosomes and lysosomes and mediates intracellular cholesterol trafficking via binding of cholesterol to its N-terminal domain. It is predicted to have a cytoplasmic C-terminus, 13 transmembrane domains, and 3 large loops in the lumen of the endosome - the last loop being at the N-terminus. This protein transports low-density lipoproteins to late endosomal/lysosomal compartments where they are hydrolized and released as free cholesterol. Defects in this gene cause Niemann-Pick type C disease, a rare autosomal recessive neurodegenerative disorder characterized by over accumulation of cholesterol and glycosphingolipids in late endosomal/lysosomal compartments. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK |
Sequence Similarities : | Belongs to the patched family.Contains 1 SSD (sterol-sensing) domain. |
Gene Name | NPC1 Niemann-Pick disease, type C1 [ Homo sapiens ] |
Official Symbol | NPC1 |
Synonyms | NPC1; Niemann-Pick disease, type C1; Niemann-Pick C1 protein; |
Gene ID | 4864 |
mRNA Refseq | NM_000271 |
Protein Refseq | NP_000262 |
MIM | 607623 |
Uniprot ID | O15118 |
Chromosome Location | 18q11-q12 |
Pathway | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; |
Function | hedgehog receptor activity; protein binding; receptor activity; sterol transporter activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
NPC1-8054Z | Recombinant Zebrafish NPC1 | +Inquiry |
NPC1-1339H | Recombinant Human NPC1 protein, His/FLAG-tagged | +Inquiry |
NPC1-1338H | Recombinant Human NPC1 protein, His-tagged | +Inquiry |
NPC1-29132TH | Recombinant Human NPC1 | +Inquiry |
NPC1-29133TH | Recombinant Human NPC1, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPC1 Products
Required fields are marked with *
My Review for All NPC1 Products
Required fields are marked with *
0
Inquiry Basket