"NPRL2" Related Products

Expand

Recombinant Human NPRL2, His-tagged

Cat.No.: NPRL2-29156TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-330 of Human NPR2L with N terminal His tag; MWt 38kDa.
Description: NPR2L is homologous to yeast nitrogen permease and is a candidate tumor suppressor, being a negative regulator of cell cycle. Most abundant in skeletal muscle, followed by brain, liver, and pancreas, with lower amounts in lung, kidney, placenta, and heart. Expressed in most lung cancer cell lines tested. There are two isoforms, produced by alternative splicing.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 121 μl aqua dest
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTV QVYIITKPELQNKLITVTAMEKKLIGCPVCIEHKKYSR NALLFNLGFVCDAQAKTCALEPIVKKLAGYLTTLELES SFVSMEESKQKLVPIMTILLEELNASGRCTLPIDESNT IHLKVIEQRPDPPVAQEYDVPVFTKDKEDFFNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGV VTLVSILQYSNVYCPTPKVQDLVDDKSLQEACLSYVTK QGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHV DERKLIQFGLMKNLIRRLQKYP
Gene Name: NPRL2 nitrogen permease regulator-like 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol: NPRL2
Synonyms: NPRL2; nitrogen permease regulator-like 2 (S. cerevisiae); tumor suppressor candidate 4 , TUSC4; nitrogen permease regulator 2-like protein; NPR2; NPR2L;
Gene ID: 10641
mRNA Refseq: NM_006545
Protein Refseq: NP_006536
MIM: 607072
Uniprot ID: Q8WTW4
Chromosome Location: 3p21.3
Function: protein binding; protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.