Recombinant Human NTRK2, Fc-tagged
Cat.No. : | NTRK2-31621TH |
Product Overview : | Recombinant fragment corresponding to amino acids 32-428 of human TrkB fused to the Fc region of human IgG1 expressed in modified human 293 cells, 90-115kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternate transcriptional splice variants encoding different isoforms have been found for this gene. |
Conjugation : | Fc |
Tissue specificity : | Isoform TrkB is widely expressed, mainly in the nervous tissue. In the CNS, expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain stem, and spinal cord. In the peripheral nervous syst |
Biological activity : | NTRK2-31621TH chimera bound to protein A sepharose beads is able to pull down its ligand, BDNF. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:CPTSCKCSASRIWCSDPSPGIVAFPRLEP NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTI VDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFR HLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDL YCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSI TLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRI TNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTIT FLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESK YICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNE YGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAA NDIGDTTNRSNEIPSTDVTDKTGRIPKVDKKVEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 LRRNT domain.Contains 1 prot |
Gene Name : | NTRK2 neurotrophic tyrosine kinase, receptor, type 2 [ Homo sapiens ] |
Official Symbol : | NTRK2 |
Synonyms : | NTRK2; neurotrophic tyrosine kinase, receptor, type 2; BDNF/NT-3 growth factors receptor; TRKB; |
Gene ID : | 4915 |
mRNA Refseq : | NM_001007097 |
Protein Refseq : | NP_001007098 |
MIM : | 600456 |
Uniprot ID : | Q16620 |
Chromosome Location : | 9q22.1 |
Pathway : | Activation of TRKA receptors, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; NGF-independant TRKA activation, organism-specific biosystem; |
Function : | ATP binding; neurotrophin binding; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; |
Products Types
◆ Recombinant Protein | ||
NTRK2-470H | Recombinant Human NTRK2 Protein, Fc-tagged | +Inquiry |
NTRK2-469H | Recombinant Human NTRK2 Protein, His-tagged | +Inquiry |
NTRK2-2937R | Recombinant Rhesus Macaque NTRK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTRK2-24H | Recombinant Human NTRK2 Protein (32-430aa), C-His tagged | +Inquiry |
Ntrk2-4523M | Recombinant Mouse Ntrk2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
NTRK2-1024CCL | Recombinant Canine NTRK2 cell lysate | +Inquiry |
NTRK2-1300RCL | Recombinant Rat NTRK2 cell lysate | +Inquiry |
NTRK2-2683HCL | Recombinant Human NTRK2 cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-1629 | TrkB Functional Assay Kit | +Inquiry |
Kit-1547 | U2OS TrkB Bioassay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All NTRK2 Products
Required fields are marked with *
My Review for All NTRK2 Products
Required fields are marked with *
0
Inquiry Basket