"NTRK2" Related Products

Expand
Expand

Recombinant Human NTRK2, Fc-tagged

Cat.No.: NTRK2-31621TH
Product Overview: Recombinant fragment corresponding to amino acids 32-428 of human TrkB fused to the Fc region of human IgG1 expressed in modified human 293 cells, 90-115kDa.
Description: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternate transcriptional splice variants encoding different isoforms have been found for this gene.
Conjugation: Fc
Tissue specificity: Isoform TrkB is widely expressed, mainly in the nervous tissue. In the CNS, expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain stem, and spinal cord. In the peripheral nervous syst
Biological activity: NTRK2-31621TH chimera bound to protein A sepharose beads is able to pull down its ligand, BDNF.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:CPTSCKCSASRIWCSDPSPGIVAFPRLEP NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTI VDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFR HLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDL YCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSI TLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRI TNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTIT FLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESK YICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNE YGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAA NDIGDTTNRSNEIPSTDVTDKTGRIPKVDKKVEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 LRRNT domain.Contains 1 prot
Gene Name: NTRK2 neurotrophic tyrosine kinase, receptor, type 2 [ Homo sapiens ]
Official Symbol: NTRK2
Synonyms: NTRK2; neurotrophic tyrosine kinase, receptor, type 2; BDNF/NT-3 growth factors receptor; TRKB;
Gene ID: 4915
mRNA Refseq: NM_001007097
Protein Refseq: NP_001007098
MIM: 600456
Uniprot ID: Q16620
Chromosome Location: 9q22.1
Pathway: Activation of TRKA receptors, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; NGF-independant TRKA activation, organism-specific biosystem;
Function: ATP binding; neurotrophin binding; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.