"NTRK3" Related Products

Expand
Expand

Recombinant Human NTRK3

Cat.No.: NTRK3-31623TH
Product Overview: Recombinant fragment,extracellular region corresponding to amino acids 32-428 of Human TrkC
Description: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene.
Tissue specificity: Widely expressed but mainly in nervous tissue. Isoform B is expressed at higher levels in adult brain than in fetal brain.
Form: Lyophilised:Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze tha
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:CPANCVCSKTEINCRRPDDGNLFPLLEGQ DSGNSNGNANINITDISRNITSIHIENWRSLHTLNAVD MELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNR LTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQE QGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSH VNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTH QTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGM SNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPT LHWLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTH YNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEEDGSSNTKVDKKVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 2 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 protein kinase domain.
Gene Name: NTRK3 neurotrophic tyrosine kinase, receptor, type 3 [ Homo sapiens ]
Official Symbol: NTRK3
Synonyms: NTRK3; neurotrophic tyrosine kinase, receptor, type 3; NT-3 growth factor receptor; TRKC;
Gene ID: 4916
mRNA Refseq: NM_001007156
Protein Refseq: NP_001007157
MIM: 191316
Uniprot ID: Q16288
Chromosome Location: 15q24-q25
Pathway: Neurotrophic factor-mediated Trk receptor signaling, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem;
Function: ATP binding; kinase activity; neurotrophin binding; neurotrophin receptor activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.