Active Recombinant Human OLIG2, GST-tagged

Cat.No. : OLIG2-28318TH
Product Overview : Human OLIG2 full-length ORF ( AAH36245.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
Availability December 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
Form : Liquid
Bio-activity : Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using murine NR6R/3T3 cells is less than 1.8 ng/ml, corresponding to a specific activity of > 5.6 × 10~5 IU/mg
Molecular Mass : 58.8 kDa
AA Sequence : MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPVDKLGGSGF KSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIA TLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPA AAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV PPPHHHVSAMGAGSLPRLTSDAK
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens ]
Official Symbol OLIG2
Synonyms OLIG2; oligodendrocyte lineage transcription factor 2; oligodendrocyte transcription factor 2; protein kinase C-binding protein 2; class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; basic domain, helix-loop-helix protein, class B, 1; oligodendrocyte-specific bHLH transcription factor 2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19;
Gene ID 10215
mRNA Refseq NM_005806
Protein Refseq NP_005797
Function DNA binding; HMG box domain binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLIG2 Products

Required fields are marked with *

My Review for All OLIG2 Products

Required fields are marked with *

0
cart-icon
0
compare icon