Recombinant Human OLIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : OLIG2-3842H
Product Overview : OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
Molecular Mass : 32.2 kDa
AA Sequence : MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKXSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens (human) ]
Official Symbol OLIG2
Synonyms OLIG2; oligodendrocyte lineage transcription factor 2; oligodendrocyte transcription factor 2; protein kinase C-binding protein 2; class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; basic domain, helix-loop-helix protein, class B, 1; oligodendrocyte-specific bHLH transcription factor 2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19;
Gene ID 10215
mRNA Refseq NM_005806
Protein Refseq NP_005797
MIM 606386
UniProt ID Q13516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OLIG2 Products

Required fields are marked with *

My Review for All OLIG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon