Recombinant Human OLIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | OLIG2-3842H |
Product Overview : | OLIG2 MS Standard C13 and N15-labeled recombinant protein (NP_005797) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKXSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens (human) ] |
Official Symbol | OLIG2 |
Synonyms | OLIG2; oligodendrocyte lineage transcription factor 2; oligodendrocyte transcription factor 2; protein kinase C-binding protein 2; class B basic helix-loop-helix protein 1; class E basic helix-loop-helix protein 19; human protein kinase C-binding protein RACK17; basic domain, helix-loop-helix protein, class B, 1; oligodendrocyte-specific bHLH transcription factor 2; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19; |
Gene ID | 10215 |
mRNA Refseq | NM_005806 |
Protein Refseq | NP_005797 |
MIM | 606386 |
UniProt ID | Q13516 |
◆ Recombinant Proteins | ||
OLIG2-38H | Recombinant Human OLIG2, GST-tagged | +Inquiry |
OLIG2-1578H | Recombinant Human OLIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
OLIG2-28318TH | Active Recombinant Human OLIG2, GST-tagged | +Inquiry |
OLIG2-3842H | Recombinant Human OLIG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OLIG2-4438H | Recombinant Human OLIG2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG2-1248HCL | Recombinant Human OLIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLIG2 Products
Required fields are marked with *
My Review for All OLIG2 Products
Required fields are marked with *
0
Inquiry Basket