Recombinant Human OLIG2 protein, T7/His-tagged
Cat.No. : | OLIG2-185H |
Product Overview : | Recombinant human Olig2 cDNA (323 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDC PPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMH DLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAP LPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPL GGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens ] |
Official Symbol | OLIG2 |
Synonyms | OLIG2; protein kinase C-binding protein 2; basic domain, helix-loop-helix protein, class B, 1; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19; |
Gene ID | 10215 |
mRNA Refseq | NM_005806 |
Protein Refseq | NP_005797 |
MIM | |
UniProt ID | |
Function | DNA binding; HMG box domain binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
OLIG2-1769HFL | Recombinant Full Length Human OLIG2 Protein, C-Flag-tagged | +Inquiry |
OLIG2-28318TH | Active Recombinant Human OLIG2, GST-tagged | +Inquiry |
OLIG2-185H | Recombinant Human OLIG2 protein, T7/His-tagged | +Inquiry |
OLIG2-1578H | Recombinant Human OLIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
OLIG2-9574Z | Recombinant Zebrafish OLIG2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG2-1248HCL | Recombinant Human OLIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OLIG2 Products
Required fields are marked with *
My Review for All OLIG2 Products
Required fields are marked with *
0
Inquiry Basket