Recombinant Human OLIG2 protein, T7/His-tagged
| Cat.No. : | OLIG2-185H |
| Product Overview : | Recombinant human Olig2 cDNA (323 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDC PPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMH DLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAP LPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPL GGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | OLIG2 oligodendrocyte lineage transcription factor 2 [ Homo sapiens ] |
| Official Symbol | OLIG2 |
| Synonyms | OLIG2; protein kinase C-binding protein 2; basic domain, helix-loop-helix protein, class B, 1; BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19; |
| Gene ID | 10215 |
| mRNA Refseq | NM_005806 |
| Protein Refseq | NP_005797 |
| MIM | |
| UniProt ID | |
| Function | DNA binding; HMG box domain binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
| ◆ Recombinant Proteins | ||
| OLIG2-1578H | Recombinant Human OLIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| OLIG2-38H | Recombinant Human OLIG2, GST-tagged | +Inquiry |
| OLIG2-185H | Recombinant Human OLIG2 protein, T7/His-tagged | +Inquiry |
| OLIG2-353HF | Active Recombinant Full Length Human OLIG2 Protein, GST-tagged | +Inquiry |
| OLIG2-1769HFL | Recombinant Full Length Human OLIG2 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OLIG2-1248HCL | Recombinant Human OLIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OLIG2 Products
Required fields are marked with *
My Review for All OLIG2 Products
Required fields are marked with *



