"PCOLCE" Related Products

Expand
Expand

Recombinant Human PCOLCE

Cat.No.: PCOLCE-30795TH
Product Overview: Recombinant full length Human PCOLCE with N terminal proprietary tag; predicted MW: 75kDa inclusive of tag.AAH00574.1, Q15113.
Description: Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
Protein length: 449 amino acids
Molecular Weight: 75.000kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGD VKGESGYVASEGFPNLYPPNKECIWTITVPEGQTVSLSFR VFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL VAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCG GRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIAL TFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV PGSISSEGNELLVQF
Sequence Similarities: Contains 2 CUB domains.Contains 1 NTR domain.
Gene Name: PCOLCE procollagen C-endopeptidase enhancer [ Homo sapiens ]
Official Symbol: PCOLCE
Synonyms: PCOLCE; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; PCPE; PCPE1; procollagen C proteinase enhancer 1; procollagen; type 1; COOH terminal proteinase enhancer;
Gene ID: 5118
mRNA Refseq: NM_002593
Protein Refseq: NP_002584
MIM: 600270
Uniprot ID: Q15113
Chromosome Location: 7q22
Function: collagen binding; heparin binding; peptidase activator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.