"PI4KA" Related Products

Recombinant Human PI4KA

Cat.No.: PI4KA-30331TH
Product Overview: Recombinant fragment of Human Phosphatidylinositol 4 kinase III alpha protein, Isoform 2 with N-terminal proprietary tag. Predicted MW 37.73kDa.
Description: This gene encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Two transcript variants encoding different isoforms have been described for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa
Source: Wheat germ
Tissue specificity: Expressed ubiquitously. Highest levels in placenta and brain. Little or no expression in lung, liver, pancreas, testis or leukocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFS SMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDK MGYVREYILWAASKSQLLAHQFIWNMKTNI
Sequence Similarities: Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.Contains 1 PI3K/PI4K domain.
Gene Name: PI4KA phosphatidylinositol 4-kinase, catalytic, alpha [ Homo sapiens ]
Official Symbol: PI4KA
Synonyms: PI4KA; phosphatidylinositol 4-kinase, catalytic, alpha; PIK4CA; phosphatidylinositol 4-kinase alpha; PI4K ALPHA; pi4K230;
Gene ID: 5297
mRNA Refseq: NM_002650
Protein Refseq: NP_002641
MIM: 600286
Uniprot ID: P42356
Chromosome Location: 22q11.21
Pathway: 3-phosphoinositide biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=>
Function: 1-phosphatidylinositol 4-kinase activity; ATP binding; kinase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.