Recombinant Human PI4KA
Cat.No. : | PI4KA-30331TH |
Product Overview : | Recombinant fragment of Human Phosphatidylinositol 4 kinase III alpha protein, Isoform 2 with N-terminal proprietary tag. Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Two transcript variants encoding different isoforms have been described for this gene. |
Molecular Weight : | 37.730kDa |
Tissue specificity : | Expressed ubiquitously. Highest levels in placenta and brain. Little or no expression in lung, liver, pancreas, testis or leukocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFS SMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDK MGYVREYILWAASKSQLLAHQFIWNMKTNI |
Sequence Similarities : | Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.Contains 1 PI3K/PI4K domain. |
Gene Name | PI4KA phosphatidylinositol 4-kinase, catalytic, alpha [ Homo sapiens ] |
Official Symbol | PI4KA |
Synonyms | PI4KA; phosphatidylinositol 4-kinase, catalytic, alpha; PIK4CA; phosphatidylinositol 4-kinase alpha; PI4K ALPHA; pi4K230; |
Gene ID | 5297 |
mRNA Refseq | NM_002650 |
Protein Refseq | NP_002641 |
MIM | 600286 |
Uniprot ID | P42356 |
Chromosome Location | 22q11.21 |
Pathway | 3-phosphoinositide biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=> |
Function | 1-phosphatidylinositol 4-kinase activity; ATP binding; kinase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
PI4KA-1700H | Recombinant Human PI4KA, His-tagged | +Inquiry |
PI4KA-4905H | Recombinant Human PI4KA Protein (Met1-Tyr300), N-GST tagged | +Inquiry |
PI4KA-1701H | Recombinant Human PI4KA protein, His-GST-tagged | +Inquiry |
PI4KA-143HFL | Active Recombinant Full Length Human PI4KA Protein, N-Flag-tagged | +Inquiry |
PI4KA-117H | Recombinant Human PI4KA, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI4KA-3207HCL | Recombinant Human PI4KA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PI4KA Products
Required fields are marked with *
My Review for All PI4KA Products
Required fields are marked with *
0
Inquiry Basket