Recombinant Human PI4KA
Cat.No. : | PI4KA-30331TH |
Product Overview : | Recombinant fragment of Human Phosphatidylinositol 4 kinase III alpha protein, Isoform 2 with N-terminal proprietary tag. Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Two transcript variants encoding different isoforms have been described for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa |
Source : | Wheat germ |
Tissue specificity : | Expressed ubiquitously. Highest levels in placenta and brain. Little or no expression in lung, liver, pancreas, testis or leukocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFS SMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDK MGYVREYILWAASKSQLLAHQFIWNMKTNI |
Sequence Similarities : | Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.Contains 1 PI3K/PI4K domain. |
Gene Name : | PI4KA phosphatidylinositol 4-kinase, catalytic, alpha [ Homo sapiens ] |
Official Symbol : | PI4KA |
Synonyms : | PI4KA; phosphatidylinositol 4-kinase, catalytic, alpha; PIK4CA; phosphatidylinositol 4-kinase alpha; PI4K ALPHA; pi4K230; |
Gene ID : | 5297 |
mRNA Refseq : | NM_002650 |
Protein Refseq : | NP_002641 |
MIM : | 600286 |
Uniprot ID : | P42356 |
Chromosome Location : | 22q11.21 |
Pathway : | 3-phosphoinositide biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=> |
Function : | 1-phosphatidylinositol 4-kinase activity; ATP binding; kinase activity; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
PI4KA-4099R | Recombinant Rat PI4KA Protein, His (Fc)-Avi-tagged | +Inquiry |
PI4KA-161H | Active Recombinant Human PI4KA protein, GST-tagged | +Inquiry |
PI4KA-4439R | Recombinant Rat PI4KA Protein | +Inquiry |
PI4KA-117H | Recombinant Human PI4KA, GST-tagged | +Inquiry |
PI4KA-1701H | Recombinant Human PI4KA protein, His-GST-tagged | +Inquiry |
◆ Lysates | ||
PI4KA-3207HCL | Recombinant Human PI4KA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket