"PMVK" Related Products

Recombinant Human PMVK, His-tagged

Cat.No.: PMVK-30069TH
Product Overview: Recombinant full length Human PMVK with an N terminal His tag; 212aa, 24.1kDa.
Description: This gene encodes a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate, the fifth reaction of the cholesterol biosynthetic pathway. Studies in rat show that the message level and the enzyme activity of this protein is regulated by sterol, and that this regulation is coordinated with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis.
Protein length: 192 amino acids
Conjugation: HIS
Molecular Weight: 24.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Gene Name: PMVK phosphomevalonate kinase [ Homo sapiens ]
Official Symbol: PMVK
Synonyms: PMVK; phosphomevalonate kinase; HUMPMKI; PMK; PMKA;
Gene ID: 10654
mRNA Refseq: NM_006556
Protein Refseq: NP_006547
MIM: 607622
Uniprot ID: Q15126
Chromosome Location: 1p13-q23
Pathway: C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function: ATP binding; nucleotide binding; phosphomevalonate kinase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.