Recombinant Human PMVK, His-tagged

Cat.No. : PMVK-30069TH
Product Overview : Recombinant full length Human PMVK with an N terminal His tag; 212aa, 24.1kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 192 amino acids
Description : This gene encodes a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate, the fifth reaction of the cholesterol biosynthetic pathway. Studies in rat show that the message level and the enzyme activity of this protein is regulated by sterol, and that this regulation is coordinated with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis.
Conjugation : HIS
Molecular Weight : 24.100kDa inclusive of tags
Tissue specificity : Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Gene Name PMVK phosphomevalonate kinase [ Homo sapiens ]
Official Symbol PMVK
Synonyms PMVK; phosphomevalonate kinase; HUMPMKI; PMK; PMKA;
Gene ID 10654
mRNA Refseq NM_006556
Protein Refseq NP_006547
MIM 607622
Uniprot ID Q15126
Chromosome Location 1p13-q23
Pathway C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function ATP binding; nucleotide binding; phosphomevalonate kinase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMVK Products

Required fields are marked with *

My Review for All PMVK Products

Required fields are marked with *

0
cart-icon
0
compare icon