Recombinant Human PMVK, His-tagged
Cat.No. : | PMVK-30069TH |
Product Overview : | Recombinant full length Human PMVK with an N terminal His tag; 212aa, 24.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 192 amino acids |
Description : | This gene encodes a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate, the fifth reaction of the cholesterol biosynthetic pathway. Studies in rat show that the message level and the enzyme activity of this protein is regulated by sterol, and that this regulation is coordinated with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis. |
Conjugation : | HIS |
Molecular Weight : | 24.100kDa inclusive of tags |
Tissue specificity : | Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL |
Gene Name | PMVK phosphomevalonate kinase [ Homo sapiens ] |
Official Symbol | PMVK |
Synonyms | PMVK; phosphomevalonate kinase; HUMPMKI; PMK; PMKA; |
Gene ID | 10654 |
mRNA Refseq | NM_006556 |
Protein Refseq | NP_006547 |
MIM | 607622 |
Uniprot ID | Q15126 |
Chromosome Location | 1p13-q23 |
Pathway | C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; phosphomevalonate kinase activity; transferase activity; |
◆ Recombinant Proteins | ||
PMVK-5431Z | Recombinant Zebrafish PMVK | +Inquiry |
PMVK-444H | Recombinant Human PMVK, His tagged | +Inquiry |
PMVK-2823H | Recombinant Human Phosphomevalonate Kinase, His-tagged | +Inquiry |
PMVK-6131H | Recombinant Human PMVK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PMVK-1275H | Recombinant Human PMVK protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMVK-3084HCL | Recombinant Human PMVK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMVK Products
Required fields are marked with *
My Review for All PMVK Products
Required fields are marked with *