"PRDX6" Related Products

Expand
Expand

Recombinant Human PRDX6, His-tagged

Cat.No.: PRDX6-27600TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-224 of Human Peroxiredoxin 6 with an N terminal His tag; Predicted MWt 26 kDa.
Description: The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 105 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHP RDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVED HLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGM LDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTG RNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIP EEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Sequence Similarities: Belongs to the ahpC/TSA family. Rehydrin subfamily.Contains 1 thioredoxin domain.
Gene Name: PRDX6 peroxiredoxin 6 [ Homo sapiens ]
Official Symbol: PRDX6
Synonyms: PRDX6; peroxiredoxin 6; peroxiredoxin-6; 1 Cys; aiPLA2; AOP2; KIAA0106; MGC46173; NSGPx; p29; PRX;
Gene ID: 9588
mRNA Refseq: NM_004905
Protein Refseq: NP_004896
MIM: 602316
Uniprot ID: P30041
Chromosome Location: 1q24.1
Pathway: Metabolic pathways, organism-specific biosystem; Phenylalanine metabolism, organism-specific biosystem; Phenylalanine metabolism, conserved biosystem;
Function: antioxidant activity; glutathione peroxidase activity; hydrolase activity; oxidoreductase activity; peroxiredoxin activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.