Recombinant Human PRDX6, His-tagged
| Cat.No. : | PRDX6-27600TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-224 of Human Peroxiredoxin 6 with an N terminal His tag; Predicted MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-224 a.a. |
| Description : | The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 105 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHP RDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVED HLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGM LDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTG RNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIP EEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
| Sequence Similarities : | Belongs to the ahpC/TSA family. Rehydrin subfamily.Contains 1 thioredoxin domain. |
| Full Length : | Full L. |
| Gene Name | PRDX6 peroxiredoxin 6 [ Homo sapiens ] |
| Official Symbol | PRDX6 |
| Synonyms | PRDX6; peroxiredoxin 6; peroxiredoxin-6; 1 Cys; aiPLA2; AOP2; KIAA0106; MGC46173; NSGPx; p29; PRX; |
| Gene ID | 9588 |
| mRNA Refseq | NM_004905 |
| Protein Refseq | NP_004896 |
| MIM | 602316 |
| Uniprot ID | P30041 |
| Chromosome Location | 1q24.1 |
| Pathway | Metabolic pathways, organism-specific biosystem; Phenylalanine metabolism, organism-specific biosystem; Phenylalanine metabolism, conserved biosystem; |
| Function | antioxidant activity; glutathione peroxidase activity; hydrolase activity; oxidoreductase activity; peroxiredoxin activity; |
| ◆ Recombinant Proteins | ||
| PRDX6-13327M | Recombinant Mouse PRDX6 Protein | +Inquiry |
| PRDX6-27600TH | Recombinant Human PRDX6, His-tagged | +Inquiry |
| PRDX6-4321R | Recombinant Rat PRDX6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRDX6-11061Z | Recombinant Zebrafish PRDX6 | +Inquiry |
| Prdx6-331R | Recombinant Rat Prdx6 Protein, His/GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRDX6-401HKCL | Human PRDX6 Knockdown Cell Lysate | +Inquiry |
| PRDX6-2877HCL | Recombinant Human PRDX6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRDX6 Products
Required fields are marked with *
My Review for All PRDX6 Products
Required fields are marked with *



