Recombinant Human PSAP, His-tagged

• Cat.No.: PSAP-30347TH
• Product Overview: Recombinant fragment, corresponding to amino acids 255-526 of Human PSAP with N terminal His tag; 272 amino acids, 32kDa.

Specification

• Description: This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 58 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: MMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNV IPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLID NNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDP YQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS AHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHV WN
• Sequence Similarities: Contains 2 saposin A-type domains.Contains 4 saposin B-type domains.

Gene Information

• Gene Name: PSAP prosaposin [ Homo sapiens ]
• Official Symbol: PSAP
• Synonyms: PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy
• Gene ID: 5660
• mRNA Refseq: NM_001042465
• Protein Refseq: NP_001035930
• MIM: 176801
• Uniprot ID: P07602
• Chromosome Location: 10q21-q22
• Pathway: Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem
• Function: enzyme activator activity; lipid binding