"PSAP" Related Products

Expand
Expand
Expand

Recombinant Human PSAP, His-tagged

Cat.No.: PSAP-30347TH
Product Overview: Recombinant fragment, corresponding to amino acids 255-526 of Human PSAP with N terminal His tag; 272 amino acids, 32kDa.
Description: This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 58 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: MMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNV IPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLID NNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDP YQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS AHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHV WN
Sequence Similarities: Contains 2 saposin A-type domains.Contains 4 saposin B-type domains.
Gene Name: PSAP prosaposin [ Homo sapiens ]
Official Symbol: PSAP
Synonyms: PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy;
Gene ID: 5660
mRNA Refseq: NM_001042465
Protein Refseq: NP_001035930
MIM: 176801
Uniprot ID: P07602
Chromosome Location: 10q21-q22
Pathway: Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem;
Function: enzyme activator activity; lipid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.