Recombinant Human PSAP, His-tagged
Cat.No. : | PSAP-30347TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 255-526 of Human PSAP with N terminal His tag; 272 amino acids, 32kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 255-526 a.a. |
Description : | This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | MMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNV IPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLID NNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDP YQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS AHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHV WN |
Sequence Similarities : | Contains 2 saposin A-type domains.Contains 4 saposin B-type domains. |
Gene Name | PSAP prosaposin [ Homo sapiens ] |
Official Symbol | PSAP |
Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; |
Gene ID | 5660 |
mRNA Refseq | NM_001042465 |
Protein Refseq | NP_001035930 |
MIM | 176801 |
Uniprot ID | P07602 |
Chromosome Location | 10q21-q22 |
Pathway | Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; |
Function | enzyme activator activity; lipid binding; |
◆ Recombinant Proteins | ||
PSAP-189H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
PSAP-18H | Recombinant Human PSAP protein, GST-tagged | +Inquiry |
PSAP-5503G | Recombinant Guinea pig PSAP protein, His-tagged | +Inquiry |
PSAP-6374C | Recombinant Chicken PSAP | +Inquiry |
PSAP-7197M | Recombinant Mouse PSAP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *
0
Inquiry Basket