Recombinant Human PSAP, His-tagged
| Cat.No. : | PSAP-30347TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 255-526 of Human PSAP with N terminal His tag; 272 amino acids, 32kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 255-526 a.a. |
| Description : | This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 58 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | MMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNV IPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLID NNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDP YQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS AHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHV WN |
| Sequence Similarities : | Contains 2 saposin A-type domains.Contains 4 saposin B-type domains. |
| Gene Name | PSAP prosaposin [ Homo sapiens ] |
| Official Symbol | PSAP |
| Synonyms | PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy; |
| Gene ID | 5660 |
| mRNA Refseq | NM_001042465 |
| Protein Refseq | NP_001035930 |
| MIM | 176801 |
| Uniprot ID | P07602 |
| Chromosome Location | 10q21-q22 |
| Pathway | Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; |
| Function | enzyme activator activity; lipid binding; |
| ◆ Recombinant Proteins | ||
| PSAP-6022H | Recombinant Human PSAP Protein (Gly17-Asn524), N-His tagged | +Inquiry |
| PSAP-4415R | Recombinant Rat PSAP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSAP-6374C | Recombinant Chicken PSAP | +Inquiry |
| PSAP-30347TH | Recombinant Human PSAP, His-tagged | +Inquiry |
| PSAP-611HF | Recombinant Full Length Human PSAP Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSAP-2793HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
| PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSAP Products
Required fields are marked with *
My Review for All PSAP Products
Required fields are marked with *
