Recombinant Human PSAP, His-tagged

Cat.No. : PSAP-30347TH
Product Overview : Recombinant fragment, corresponding to amino acids 255-526 of Human PSAP with N terminal His tag; 272 amino acids, 32kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 255-526 a.a.
Description : This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 58 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : MMMHMDQQPKEICALVGFCDEVKEMPMQTLVPAKVASKNV IPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLID NNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGF CEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDP YQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACPS AHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHV WN
Sequence Similarities : Contains 2 saposin A-type domains.Contains 4 saposin B-type domains.
Gene Name PSAP prosaposin [ Homo sapiens ]
Official Symbol PSAP
Synonyms PSAP; prosaposin; GLBA, SAP1, sphingolipid activator protein 1; proactivator polypeptide; variant Gaucher disease and variant metachromatic leukodystrophy;
Gene ID 5660
mRNA Refseq NM_001042465
Protein Refseq NP_001035930
MIM 176801
Uniprot ID P07602
Chromosome Location 10q21-q22
Pathway Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem;
Function enzyme activator activity; lipid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSAP Products

Required fields are marked with *

My Review for All PSAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon