"PSEN2" Related Products

Expand

Recombinant Human PSEN2

Cat.No.: PSEN2-28527TH
Product Overview: Recombinant fragment corresponding to amino acids 1-86 of Human Presenilin 2 with an N terminal proprietary tag; Predicted MWt 35.09 kDa.
Description: Alzheimers disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
Protein length: 86 amino acids
Molecular Weight: 35.090kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 1 is seen in the placenta, skeletal muscle and heart while isoform 2 is seen in the heart, brain, placenta, liver, skeletal muscle and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAK
Sequence Similarities: Belongs to the peptidase A22A family.
Gene Name: PSEN2 presenilin 2 (Alzheimer disease 4) [ Homo sapiens ]
Official Symbol: PSEN2
Synonyms: PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2;
Gene ID: 5664
mRNA Refseq: NM_000447
Protein Refseq: NP_000438
MIM: 600759
Uniprot ID: P49810
Chromosome Location: 1q31-q42
Pathway: A third proteolytic cleavage releases NICD, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem;
Function: aspartic-type endopeptidase activity; endopeptidase activity; endopeptidase activity; peptidase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.