Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged
Cat.No. : | PSEN2-28H |
Product Overview : | Recombinant Human PSEN2 Protein (305-384aa) with His-tag was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 305-384aa |
Description : | Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified. |
Tag : | C-His |
Molecular Mass : | 10 kDa |
AA Sequence : | MAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH7.4 |
Gene Name | PSEN2 presenilin 2 (Alzheimer disease 4) [Homo sapiens (human)] |
Official Symbol | PSEN2 |
Synonyms | PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2; AD5; E5-1; PS-2; AD3LP; STM-2; CMD1V |
Gene ID | 5664 |
mRNA Refseq | NM_000447 |
Protein Refseq | NP_000438 |
MIM | 600759 |
UniProt ID | P49810 |
◆ Recombinant Proteins | ||
PSEN2-3644R | Recombinant Rhesus monkey PSEN2 Protein, His-tagged | +Inquiry |
PSEN2-28H | Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged | +Inquiry |
PSEN2-12H | Recombinant Human PSEN2 Protein(1-87 aa), GST-tagged | +Inquiry |
PSEN2-5875C | Recombinant Chicken PSEN2 | +Inquiry |
PSEN2-3462R | Recombinant Rhesus Macaque PSEN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSEN2 Products
Required fields are marked with *
My Review for All PSEN2 Products
Required fields are marked with *
0
Inquiry Basket