Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged

Cat.No. : PSEN2-28H
Product Overview : Recombinant Human PSEN2 Protein (305-384aa) with His-tag was expressed in E. coli.
Availability September 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 305-384aa
Description : Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
Tag : C-His
Molecular Mass : 10 kDa
AA Sequence : MAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4
Gene Name PSEN2 presenilin 2 (Alzheimer disease 4) [Homo sapiens (human)]
Official Symbol PSEN2
Synonyms PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2; AD5; E5-1; PS-2; AD3LP; STM-2; CMD1V
Gene ID 5664
mRNA Refseq NM_000447
Protein Refseq NP_000438
MIM 600759
UniProt ID P49810

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PSEN2 Products

Required fields are marked with *

My Review for All PSEN2 Products

Required fields are marked with *

0
cart-icon