Recombinant Human presenilin 2 (Alzheimer disease 4) Protein, His-tagged
| Cat.No. : | PSEN2-28H |
| Product Overview : | Recombinant Human PSEN2 Protein (305-384aa) with His-tag was expressed in E. coli. |
| Availability | September 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 305-384aa |
| Description : | Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified. |
| Tag : | C-His |
| Molecular Mass : | 10 kDa |
| AA Sequence : | MAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Gene Name | PSEN2 presenilin 2 (Alzheimer disease 4) [Homo sapiens (human)] |
| Official Symbol | PSEN2 |
| Synonyms | PSEN2; presenilin 2 (Alzheimer disease 4); AD4; presenilin-2; AD3L; PS2; STM2; AD5; E5-1; PS-2; AD3LP; STM-2; CMD1V |
| Gene ID | 5664 |
| mRNA Refseq | NM_000447 |
| Protein Refseq | NP_000438 |
| MIM | 600759 |
| UniProt ID | P49810 |
| ◆ Recombinant Proteins | ||
| PSEN2-28527TH | Recombinant Human PSEN2 | +Inquiry |
| PSEN2-3644R | Recombinant Rhesus monkey PSEN2 Protein, His-tagged | +Inquiry |
| PSEN2-3462R | Recombinant Rhesus Macaque PSEN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSEN2-4418R | Recombinant Rat PSEN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PSEN2-9063Z | Recombinant Zebrafish PSEN2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSEN2 Products
Required fields are marked with *
My Review for All PSEN2 Products
Required fields are marked with *
