"PSMA7" Related Products

Expand

Recombinant Human PSMA7, His-tagged

Cat.No.: PSMA7-31004TH
Product Overview: Recombinant full length Human PSMA7 with N terminal His tag; 268 amino acids with a predicted MWt 30kDa including tag.
Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. This particular subunit has been shown to interact specifically with the hepatitis B virus X protein, a protein critical to viral replication. In addition, this subunit is involved in regulating hepatitis virus C internal ribosome entry site (IRES) activity, an activity essential for viral replication. This core alpha subunit is also involved in regulating the hypoxia-inducible factor-1alpha, a transcription factor important for cellular responses to oxygen tension. Multiple isoforms of this subunit arising from alternative splicing may exist but alternative transcripts for only two isoforms have been defined. A pseudogene has been identified on chromosome 9.
Protein length: 248 amino acids
Conjugation: HIS
Molecular Weight: 30.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSYDRAITVFSPDGHLFQVE YAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKIL NPEEIEKYVAEIEKEKEENEKKKQKKAS
Sequence Similarities: Belongs to the peptidase T1A family.
Gene Name: PSMA7 proteasome (prosome, macropain) subunit, alpha type, 7 [ Homo sapiens ]
Official Symbol: PSMA7
Synonyms: PSMA7; proteasome (prosome, macropain) subunit, alpha type, 7; proteasome subunit alpha type-7; C6; HSPC; proteasome subunit RC6 1; proteasome subunit XAPC7; RC6 1; XAPC7;
Gene ID: 5688
mRNA Refseq: NM_002792
Protein Refseq: NP_002783
MIM: 606607
Uniprot ID: O14818
Chromosome Location: 20q13.33
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function: identical protein binding; peptidase activity; protein binding; threonine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.