Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
248 amino acids |
Description : |
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. This particular subunit has been shown to interact specifically with the hepatitis B virus X protein, a protein critical to viral replication. In addition, this subunit is involved in regulating hepatitis virus C internal ribosome entry site (IRES) activity, an activity essential for viral replication. This core alpha subunit is also involved in regulating the hypoxia-inducible factor-1alpha, a transcription factor important for cellular responses to oxygen tension. Multiple isoforms of this subunit arising from alternative splicing may exist but alternative transcripts for only two isoforms have been defined. A pseudogene has been identified on chromosome 9. |
Conjugation : |
HIS |
Molecular Weight : |
30.000kDa inclusive of tags |
Form : |
Liquid |
Purity : |
>90% by SDS-PAGE |
Storage buffer : |
pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol |
Storage : |
Please see Notes section |
Sequences of amino acids : |
MGSSHHHHHHSSGLVPRGSHMSYDRAITVFSPDGHLFQVE YAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKIL NPEEIEKYVAEIEKEKEENEKKKQKKAS |
Sequence Similarities : |
Belongs to the peptidase T1A family. |