Recombinant Human PSMA7, His-tagged
Cat.No. : | PSMA7-31004TH |
Product Overview : | Recombinant full length Human PSMA7 with N terminal His tag; 268 amino acids with a predicted MWt 30kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 248 amino acids |
Description : | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. This particular subunit has been shown to interact specifically with the hepatitis B virus X protein, a protein critical to viral replication. In addition, this subunit is involved in regulating hepatitis virus C internal ribosome entry site (IRES) activity, an activity essential for viral replication. This core alpha subunit is also involved in regulating the hypoxia-inducible factor-1alpha, a transcription factor important for cellular responses to oxygen tension. Multiple isoforms of this subunit arising from alternative splicing may exist but alternative transcripts for only two isoforms have been defined. A pseudogene has been identified on chromosome 9. |
Conjugation : | HIS |
Molecular Weight : | 30.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSYDRAITVFSPDGHLFQVE YAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVED PVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKIL NPEEIEKYVAEIEKEKEENEKKKQKKAS |
Sequence Similarities : | Belongs to the peptidase T1A family. |
Gene Name | PSMA7 proteasome (prosome, macropain) subunit, alpha type, 7 [ Homo sapiens ] |
Official Symbol | PSMA7 |
Synonyms | PSMA7; proteasome (prosome, macropain) subunit, alpha type, 7; proteasome subunit alpha type-7; C6; HSPC; proteasome subunit RC6 1; proteasome subunit XAPC7; RC6 1; XAPC7; |
Gene ID | 5688 |
mRNA Refseq | NM_002792 |
Protein Refseq | NP_002783 |
MIM | 606607 |
Uniprot ID | O14818 |
Chromosome Location | 20q13.33 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Function | identical protein binding; peptidase activity; protein binding; threonine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
Psma7-5177M | Recombinant Mouse Psma7 Protein, Myc/DDK-tagged | +Inquiry |
PSMA7-122H | Recombinant Human Proteasome Alpha 7 Subunit, His-tagged | +Inquiry |
PSMA7-31223TH | Recombinant Human PSMA7, His-tagged | +Inquiry |
PSMA7-415H | Recombinant Human PSMA7 Protein, His-tagged | +Inquiry |
PSMA7-1444H | Recombinant Human Proteasome (prosome, macropain) Subunit, Alpha Type, 7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA7-2776HCL | Recombinant Human PSMA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSMA7 Products
Required fields are marked with *
My Review for All PSMA7 Products
Required fields are marked with *