"PSMB10" Related Products

Expand

Recombinant Human PSMB10, His-tagged

Cat.No.: PSMB10-31221TH
Product Overview: Recombinant full length protein, (amino acids 40-237, excluding propeptide) of Human PSMB10 with N terminal His tag; 255 amino acids, 26.9 kDa inclusive of tag.
Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.
Protein length: 198 amino acids
Conjugation: HIS
Molecular Weight: 26.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.02% Tris HCl, 40% Glycerol, 0.58% Sodium chloride
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Sequence Similarities: Belongs to the peptidase T1B family.
Gene Name: PSMB10 proteasome (prosome, macropain) subunit, beta type, 10 [ Homo sapiens ]
Official Symbol: PSMB10
Synonyms: PSMB10; proteasome (prosome, macropain) subunit, beta type, 10; MECL1; proteasome subunit beta type-10; beta2i; LMP10; MGC1665;
Gene ID: 5699
mRNA Refseq: NM_002801
Protein Refseq: NP_002792
MIM: 176847
Uniprot ID: P40306
Chromosome Location: 16q22.1
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function: peptidase activity; threonine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.