"RBBP7" Related Products

Expand

Recombinant Human RBBP7

Cat.No.: RBBP7-29048TH
Product Overview: Recombinant full length Human RbAp46 (amino acids 1-425) with N terminal proprietary tag; Predicted MWt 72.82 kDa including the tag.
Description: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 425 amino acids
Molecular Weight: 72.820kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQ WPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVV ARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKP DPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHT VCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIF QVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI WQMAENIYNDEESDVTTSELEGQGS
Sequence Similarities: Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.Contains 7 WD repeats.
Gene Name: RBBP7 retinoblastoma binding protein 7 [ Homo sapiens ]
Official Symbol: RBBP7
Synonyms: RBBP7; retinoblastoma binding protein 7; histone-binding protein RBBP7; G1/S transition control protein binding protein RbAp46; histone acetyltransferase type B subunit 2; RbAp46; retinoblastoma binding protein p46; retinoblastoma binding protein RbAp46;
Gene ID: 5931
mRNA Refseq: NM_001198719
Protein Refseq: NP_001185648
MIM: 300825
Uniprot ID: Q16576
Chromosome Location: Xp22.22
Pathway: Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem; Nucleosome assembly, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.