Recombinant Human RBBP7
| Cat.No. : | RBBP7-29048TH |
| Product Overview : | Recombinant full length Human RbAp46 (amino acids 1-425) with N terminal proprietary tag; Predicted MWt 72.82 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 425 amino acids |
| Description : | This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded protein is found in many histone deacetylase complexes, including mSin3 co-repressor complex. It is also present in protein complexes involved in chromatin assembly. This protein can interact with BRCA1 tumor-suppressor gene and may have a role in the regulation of cell proliferation and differentiation. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 72.820kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQ WPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVV ARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKP DPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHT VCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIF QVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI WQMAENIYNDEESDVTTSELEGQGS |
| Sequence Similarities : | Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.Contains 7 WD repeats. |
| Gene Name | RBBP7 retinoblastoma binding protein 7 [ Homo sapiens ] |
| Official Symbol | RBBP7 |
| Synonyms | RBBP7; retinoblastoma binding protein 7; histone-binding protein RBBP7; G1/S transition control protein binding protein RbAp46; histone acetyltransferase type B subunit 2; RbAp46; retinoblastoma binding protein p46; retinoblastoma binding protein RbAp46; |
| Gene ID | 5931 |
| mRNA Refseq | NM_001198719 |
| Protein Refseq | NP_001185648 |
| MIM | 300825 |
| Uniprot ID | Q16576 |
| Chromosome Location | Xp22.22 |
| Pathway | Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem; Nucleosome assembly, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| RBBP7-5864H | Recombinant Human RBBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RBBP7-4950R | Recombinant Rat RBBP7 Protein | +Inquiry |
| RBBP7-845C | Recombinant Cynomolgus RBBP7 Protein, His-tagged | +Inquiry |
| RBBP7-29048TH | Recombinant Human RBBP7 | +Inquiry |
| RBBP7-1890HFL | Recombinant Full Length Human RBBP7 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBBP7-2489HCL | Recombinant Human RBBP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBBP7 Products
Required fields are marked with *
My Review for All RBBP7 Products
Required fields are marked with *
