"RBM14" Related Products

Recombinant Human RBM14, His-tagged

Cat.No.: RBM14-31045TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-669 of Human RBM14 with N terminal His tag, 93kDa.
Description: This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 159 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFV HMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNT WKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAF VHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPG LAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNS TGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTA QPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAAS YRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQP SASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSY GAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQS AASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYS SQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQ PVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAY GAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRG QPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTR LSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSES QLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRA AQMHSGYQRRM
Gene Name: RBM14 RNA binding motif protein 14 [ Homo sapiens ]
Official Symbol: RBM14
Synonyms: RBM14; RNA binding motif protein 14; RNA-binding protein 14; COAA; coactivator activator; DKFZp779J0927; SIP; SYT interacting protein; SYTIP1;
Gene ID: 10432
mRNA Refseq: NM_001198836
Protein Refseq: NP_001185765
MIM: 612409
Uniprot ID: Q96PK6
Chromosome Location: 11q13.2
Function: RNA binding; RNA polymerase II transcription cofactor activity; ligand-dependent nuclear receptor transcription coactivator activity; nucleic acid binding; nucleotide binding;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.