"RBP2" Related Products

Expand
Expand
Expand

Recombinant Human RBP2

Cat.No.: RBP2-30008TH
Product Overview: Recombinant fragment of Human RBP2 with N-terminal proprietary tag.Mol wt 35.53 kDa inclusive of tag.
Description: RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Higher expression in adult small intestine and to a much lesser extent in fetal kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
Sequence Similarities: Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Gene Name: RBP2 retinol binding protein 2, cellular [ Homo sapiens ]
Official Symbol: RBP2
Synonyms: RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2;
Gene ID: 5948
mRNA Refseq: NM_004164
Protein Refseq: NP_004155
MIM: 180280
Uniprot ID: P50120
Chromosome Location: 3q23
Pathway: Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Regulation of retinoblastoma protein, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem; Vitamin A uptake in enterocytes, organism-specific biosystem;
Function: lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.