"RGS19" Related Products

Expand

Recombinant Human RGS19, His-tagged

Cat.No.: RGS19-30744TH
Product Overview: Recombinant full length Human RGS19 with an N terminal His tag; 237 amino acids with tag, Predicted MWt 26.7 kDa.
Description: G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Protein length: 217 amino acids
Conjugation: HIS
Molecular Weight: 26.700kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
Gene Name: RGS19 regulator of G-protein signaling 19 [ Homo sapiens ]
Official Symbol: RGS19
Synonyms: RGS19; regulator of G-protein signaling 19; regulator of G protein signalling 19; GAIP; RGSGAIP;
Gene ID: 10287
mRNA Refseq: NM_005873
Protein Refseq: NP_005864
MIM: 605071
Uniprot ID: P49795
Chromosome Location: 20q13.33
Pathway: Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (z) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function: G-protein alpha-subunit binding; GTPase activator activity; protein binding; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.