Recombinant Human RGS19, His-tagged
Cat.No. : | RGS19-30744TH |
Product Overview : | Recombinant full length Human RGS19 with an N terminal His tag; 237 amino acids with tag, Predicted MWt 26.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 217 amino acids |
Description : | G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 26.700kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA |
Gene Name | RGS19 regulator of G-protein signaling 19 [ Homo sapiens ] |
Official Symbol | RGS19 |
Synonyms | RGS19; regulator of G-protein signaling 19; regulator of G protein signalling 19; GAIP; RGSGAIP; |
Gene ID | 10287 |
mRNA Refseq | NM_005873 |
Protein Refseq | NP_005864 |
MIM | 605071 |
Uniprot ID | P49795 |
Chromosome Location | 20q13.33 |
Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (z) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function | G-protein alpha-subunit binding; GTPase activator activity; protein binding; signal transducer activity; |
◆ Recombinant Proteins | ||
RGS19-2978H | Recombinant Human RGS19, T7-tagged | +Inquiry |
RGS19-5017R | Recombinant Rat RGS19 Protein | +Inquiry |
RGS19-7109Z | Recombinant Zebrafish RGS19 | +Inquiry |
RGS19-3874R | Recombinant Rhesus monkey RGS19 Protein, His-tagged | +Inquiry |
RGS19-3691R | Recombinant Rhesus Macaque RGS19 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS19-2379HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
RGS19-2380HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS19 Products
Required fields are marked with *
My Review for All RGS19 Products
Required fields are marked with *