Recombinant Human RGS19, His-tagged

Cat.No. : RGS19-30744TH
Product Overview : Recombinant full length Human RGS19 with an N terminal His tag; 237 amino acids with tag, Predicted MWt 26.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 217 amino acids
Description : G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Conjugation : HIS
Molecular Weight : 26.700kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, PBS, pH 7.4
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
Gene Name RGS19 regulator of G-protein signaling 19 [ Homo sapiens ]
Official Symbol RGS19
Synonyms RGS19; regulator of G-protein signaling 19; regulator of G protein signalling 19; GAIP; RGSGAIP;
Gene ID 10287
mRNA Refseq NM_005873
Protein Refseq NP_005864
MIM 605071
Uniprot ID P49795
Chromosome Location 20q13.33
Pathway Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; G alpha (z) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function G-protein alpha-subunit binding; GTPase activator activity; protein binding; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RGS19 Products

Required fields are marked with *

My Review for All RGS19 Products

Required fields are marked with *

0
cart-icon
0
compare icon