"RHOT2" Related Products

Expand

Recombinant Human RHOT2, His-tagged

Cat.No. : RHOT2-30983TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-226 of Human RHOT2 with N terminal His tag; MWt 26kDa.
Description : Mitochondrial GTPase involved in mitochondrial trafficking. RHOT2 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution. There are two isoforms.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 141 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEI TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVV CVVYDVSEEATIEKIRTKWIPLVNGGTTQGPRVPIILV GNKSDLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRN ISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQAL
Gene Name : RHOT2 ras homolog gene family, member T2 [ Homo sapiens ]
Official Symbol : RHOT2
Synonyms : RHOT2; ras homolog gene family, member T2; ARHT2, C16orf39, chromosome 16 open reading frame 39; mitochondrial Rho GTPase 2; MIRO 2;
Gene ID : 89941
mRNA Refseq : NM_138769
Protein Refseq : NP_620124
MIM : 613889
Uniprot ID : Q8IXI1
Chromosome Location : 16p13.3
Pathway : Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function : GTP binding; GTPase activity; calcium ion binding; hydrolase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.