"ROR1" Related Products

Expand
Expand

Recombinant Human ROR1

Cat.No.: ROR1-30958TH
Product Overview: Recombinant fragment of Human ROR1 with a N terminal proprietary tag. Predicted molecular weight 36.63 kDa.
Description: The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. ROR subfamily.Contains 1 FZ (frizzled) domain.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 kringle domain.Contains 1 protein kinase domain.
Gene Name: ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
Official Symbol: ROR1
Synonyms: ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1;
Gene ID: 4919
mRNA Refseq: NM_001083592
Protein Refseq: NP_001077061
MIM: 602336
Uniprot ID: Q01973
Chromosome Location: 1p32-p31
Pathway: Nuclear Receptors, organism-specific biosystem;
Function: ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.