Recombinant Human RPIA, His-tagged
Cat.No. : | RPIA-31147TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 32-311 of Human RPIA with N terminal His tag; Predicted MWt 31 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICPA PSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIV HAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLS DLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIV AGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPV SRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFD RVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDG SVNMREKPFC |
Sequence Similarities : | Belongs to the ribose 5-phosphate isomerase family. |
Gene Name : | RPIA ribose 5-phosphate isomerase A [ Homo sapiens ] |
Official Symbol : | RPIA |
Synonyms : | RPIA; ribose 5-phosphate isomerase A; ribose-5-phosphate isomerase; ribose 5 phosphate epimerase; |
Gene ID : | 22934 |
mRNA Refseq : | NM_144563 |
Protein Refseq : | NP_653164 |
MIM : | 180430 |
Uniprot ID : | P49247 |
Chromosome Location : | 2p11.2 |
Pathway : | Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Pentose Phosphate Pathway, organism-specific biosystem; Pentose phosphate pathway, organism-specific biosystem; Pentose phosphate pathway, conserved biosystem; |
Function : | isomerase activity; monosaccharide binding; ribose-5-phosphate isomerase activity; |
Products Types
◆ Recombinant Protein | ||
RPIA-7719M | Recombinant Mouse RPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
RPIA-2367E | Recombinant Escherichia coli RPIA Protein (1-219 aa) | +Inquiry |
RPIA-2359E | Recombinant Escherichia coli RPIA Protein (1-219 aa), GST-tagged | +Inquiry |
RPIA-3785R | Recombinant Rhesus Macaque RPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
RPIA-14402M | Recombinant Mouse RPIA Protein | +Inquiry |
◆ Lysates | ||
RPIA-2231HCL | Recombinant Human RPIA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket