"RPIA" Related Products

Expand

Recombinant Human RPIA, His-tagged

Cat.No.: RPIA-31147TH
Product Overview: Recombinant fragment, corresponding to amino acids 32-311 of Human RPIA with N terminal His tag; Predicted MWt 31 kDa.
Description: The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 64 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICPA PSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIV HAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLS DLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIV AGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPV SRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFD RVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDG SVNMREKPFC
Sequence Similarities: Belongs to the ribose 5-phosphate isomerase family.
Gene Name: RPIA ribose 5-phosphate isomerase A [ Homo sapiens ]
Official Symbol: RPIA
Synonyms: RPIA; ribose 5-phosphate isomerase A; ribose-5-phosphate isomerase; ribose 5 phosphate epimerase;
Gene ID: 22934
mRNA Refseq: NM_144563
Protein Refseq: NP_653164
MIM: 180430
Uniprot ID: P49247
Chromosome Location: 2p11.2
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Pentose Phosphate Pathway, organism-specific biosystem; Pentose phosphate pathway, organism-specific biosystem; Pentose phosphate pathway, conserved biosystem;
Function: isomerase activity; monosaccharide binding; ribose-5-phosphate isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.